HORDB

ID: hor004657
Uniprot ID: Q3EDI6
Protein name: CLAVATA3/ESR (CLE)-related protein 20
Gene name: CLE20
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE20p]: Expressed specifically in differentiating cells of the root. |[CLE20p]: Mostly expressed in roots, seedlings, leaves, flowers, stems and apex, and, to a lower extent, in siliques and pollen.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: SRIHVERRRFSSKPSGENREFLPSQPTFPVVDAGEILPDKRKVKTGSNPLHNKR
Length: 54(30-83)
Propeptide: MKNKNMNPSRPRLLCLIVFLFLVIVLSKASRIHVERRRFSSKPSGENREFLPSQPTFPVVDAGEILPDKRKVKTGSNPLHNKR
Signal peptide: MKNKNMNPSRPRLLCLIVFLFLVIVLSKA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance. Inhibits irreversibly root growth by reducing cell division rates in the root apical meristem.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004657_AF2.pdb

hor004657_ESM.pdb

Mass:	714250	Formula:	C271H442N88O79
Absent amino acids:	CMWY	Common amino acids:	RPS
pI:	11.57	Basic residues:	14
Polar residues:	14	Hydrophobic residues:	13
Hydrophobicity:	-114.81	Boman Index:	-18286
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	59.44
Instability Index:	8509.26	Extinction Coefficient cystines:	0
Absorbance 280nm:	0