General Information

  • ID:  hor004657
  • Uniprot ID:  Q3EDI6(30-83)
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 20
  • Gene name:  CLE20
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE20p]: Expressed specifically in differentiating cells of the root. |[CLE20p]: Mostly expressed in roots, seedlings, leaves, flowers, stems and apex, and, to a lower extent, in siliques and pollen.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  SRIHVERRRFSSKPSGENREFLPSQPTFPVVDAGEILPDKRKVKTGSNPLHNKR
  • Length:  54(30-83)
  • Propeptide:  MKNKNMNPSRPRLLCLIVFLFLVIVLSKASRIHVERRRFSSKPSGENREFLPSQPTFPVVDAGEILPDKRKVKTGSNPLHNKR
  • Signal peptide:  MKNKNMNPSRPRLLCLIVFLFLVIVLSKA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance. Inhibits irreversibly root growth by reducing cell division rates in the root apical meristem.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q3EDI6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004657_AF2.pdbhor004657_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 714250 Formula: C271H442N88O79
Absent amino acids: CMWY Common amino acids: RPS
pI: 11.57 Basic residues: 14
Polar residues: 14 Hydrophobic residues: 13
Hydrophobicity: -114.81 Boman Index: -18286
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 59.44
Instability Index: 8509.26 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA